Loading...
Statistics
Advertisement

lofi
www.lofi.space/

Lofi.space

Advertisement
Conversion Technology Metas Server
Lofi.space is hosted in Netherlands . Lofi.space uses HTTPS protocol. Number of used technologies: 2. First technologies: CSS, Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/8.5.

Technologies in use by Lofi.space

Technology

Number of occurences: 2
  • CSS
  • Html

Advertisement

Server Type

  • Microsoft-IIS/8.5

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Lofi.space

SSL certificate

    • name: /OU=Domain Control Validated/CN=*.shr.prod.ams1.secureserver.net
    • subject:
      • OU: Domain Control Validated
      • CN: *.shr.prod.ams1.secureserver.net
    • hash: 8d603d19
    • issuer:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: Starfield Technologies, Inc.
      • OU: http://certs.starfieldtech.com/repository/
      • CN: Starfield Secure Certificate Authority - G2
    • version: 2
    • serialNumber: 3367060489047868891
    • validFrom: 150320152138Z
    • validTo: 180320152138Z
    • validFrom_time_t: 1426864898
    • validTo_time_t: 1521559298
    • extensions:
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://crl.starfieldtech.com/sfig2s1-12.crl
      • certificatePolicies: Policy: 2.16.840.1.114414.1.7.23.1 CPS: http://certificates.starfieldtech.com/repository/
      • authorityInfoAccess: OCSP - URI:http://ocsp.starfieldtech.com/ CA Issuers - URI:http://certificates.starfieldtech.com/repository/sfig2.crt
      • authorityKeyIdentifier: keyid:25:45:81:68:50:26:38:3D:3B:2D:2C:BE:CD:6A:D9:B6:3D:B3:66:63
      • subjectAltName: DNS:*.shr.prod.ams1.secureserver.net, DNS:shr.prod.ams1.secureserver.net
      • subjectKeyIdentifier: 75:B1:23:34:96:3E:C1:3F:AB:8D:C3:05:C9:0A:D2:5C:E3:1C:C4:FC

Meta - Lofi.space

Number of occurences: 1
  • Name:
    Content: text/html; charset=iso-8859-1

Server / Hosting

  • IP: 188.121.43.43
  • Latitude: 52.38
  • Longitude: 4.90
  • Country: Netherlands

Rname

  • ns24.domaincontrol.com
  • ns23.domaincontrol.com
  • smtp.europe.secureserver.net
  • mailstore1.europe.secureserver.net

Target

  • dns.jomax.net

HTTP Header Response

HTTP/1.1 200 OK Content-Type: text/html Last-Modified: Wed, 15 Jun 2016 23:11:02 GMT Accept-Ranges: bytes ETag: "15b8962f5bc7d11:0" Server: Microsoft-IIS/8.5 X-Powered-By: ASP.NET X-Powered-By-Plesk: PleskWin Date: Sat, 17 Sep 2016 23:10:40 GMT Content-Length: 693 X-Cache: MISS from s_ub15 Via: 1.1 s_ub15 (squid/3.5.20) Connection: keep-alive

DNS

host: lofi.space
  1. class: IN
  2. ttl: 600
  3. type: A
  4. ip: 188.121.43.43
host: lofi.space
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns24.domaincontrol.com
host: lofi.space
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns23.domaincontrol.com
host: lofi.space
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns23.domaincontrol.com
  5. rname: dns.jomax.net
  6. serial: 2016050400
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 600
host: lofi.space
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 0
  5. target: smtp.europe.secureserver.net
host: lofi.space
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mailstore1.europe.secureserver.net

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ofi.space, www.luofi.space, www.uofi.space, www.l8ofi.space, www.8ofi.space, www.l9ofi.space, www.9ofi.space, www.ljofi.space, www.jofi.space, www.l0ofi.space, www.0ofi.space, www.lmofi.space, www.mofi.space, www.lpofi.space, www.pofi.space, www.loofi.space, www.oofi.space, www.lfi.space, www.lobfi.space, www.lbfi.space, www.lohfi.space, www.lhfi.space, www.logfi.space, www.lgfi.space, www.lojfi.space, www.ljfi.space, www.lomfi.space, www.lmfi.space, www.lo fi.space, www.l fi.space, www.lovfi.space, www.lvfi.space, www.loi.space, www.lofqi.space, www.loqi.space, www.lofi.space, www.loi.space, www.lofai.space, www.loai.space, www.lofyi.space, www.loyi.space, www.lofti.space, www.loti.space, www.lofgi.space, www.logi.space, www.lofbi.space, www.lobi.space, www.lofwi.space, www.lowi.space, www.lofsi.space, www.losi.space, www.lofdi.space, www.lodi.space, www.lofri.space, www.lori.space, www.lof3i.space, www.lo3i.space, www.lof4i.space, www.lo4i.space, www.lof.space, www.lofir.space, www.lofr.space, www.lofif.space, www.loff.space, www.lofiv.space, www.lofv.space, www.lofik.space, www.lofk.space, www.lofi,.space, www.lof,.space, www.lofib.space, www.lofb.space, www.lofig.space, www.lofg.space, www.lofit.space, www.loft.space, www.lofiy.space, www.lofy.space, www.lofiu.space, www.lofu.space, www.lofij.space, www.lofj.space, www.lofim.space, www.lofm.space, www.lofin.space, www.lofn.space,

Other websites we recently analyzed

  1. vuki.science
    Austin (United States) - 209.99.40.219
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  2. Huron Valley Cabling and Consulting
    Business for Telephone and Computer Cabling
    Mountain View (United States) - 74.125.206.121
    Server software: ghs
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 3
  3. physiciansadvancedfitnessmedicine.com
    Provo (United States) - 198.57.247.164
    Server software: nginx/1.10.1
    Technology: Html
    Number of meta tags: 2
  4. Sie werden weitergeleitet auf
    Germany - 134.119.245.118
    Server software: Apache/2.4.20
    Technology: Php
    Number of meta tags: 1
  5. lifestyle-urlaub
    Germany - 91.198.157.170
    G Analytics ID: UA-9440081-33
    Server software: Apache/2.2.21 (Win32) PHP/5.3.8 mod_perl/2.0.4 Perl/v5.10.1
    Technology: Html, Google Analytics
    Number of meta tags: 3
  6. czxtx.com
    Hong Kong - 103.61.240.87
    Server software: Microsoft-IIS/6.0
    Technology: Html, Html5, Javascript
    Number of meta tags: 1
  7. orangesunteamwear.net
    Switzerland - 141.8.224.25
    Server software: Apache
    Technology: Google Adsense, CSS, Html, Javascript, Php
    Number of Javascript: 4
    Number of meta tags: 2
  8. Affordable Car Care Auto Repair Walton Hills Ohio
    Affordable Car Care is a family owned business delivering honest & professional auto repair & maintenance services to the people of Walton Hills, Macedonia, Sagamore Hills, Northfield, Solon, and surrounding areas.
    Phoenix (United States) - 69.50.216.99
    Server software: Apache
    Technology: CSS, Html, Javascript, Share This Social Media Buttons
    Number of Javascript: 4
    Number of meta tags: 4
  9. Fastshop 24
    Shop powered by PrestaShop
    Germany - 82.165.104.11
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, Prestashop
    Number of Javascript: 12
    Number of meta tags: 5
  10. barristar.com
    Frankfurt (Germany) - 149.126.77.76
    Server software:
    Technology: Html, Iframe, Incapsula
    Number of meta tags: 1

Check Other Websites